PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04744.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 167aa    MW: 18984 Da    PI: 8.5019
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04744.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF37.62.8e-121150342
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                  i nks r   + kR++g+ K A+ L +LC+++++v+++++
  Zpz_sc04744.1.g00010.1.am.mk 11 IANKSIRRAEYKKRQEGLVKMANDLTTLCGIKACVVVYGE 50
                                  89************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.358150IPR002100Transcription factor, MADS-box
SMARTSM004329.7E-7160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.24E-15162IPR002100Transcription factor, MADS-box
CDDcd002661.17E-19278No hitNo description
PRINTSPR004045.3E-5323IPR002100Transcription factor, MADS-box
PfamPF003195.6E-121152IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MAPKKVNLQW IANKSIRRAE YKKRQEGLVK MANDLTTLCG IKACVVVYGE GKPQPEVRKF  60
DHENCERETL FLLHKTMTGH HTSLVDLTNQ DLIGIKCMVE AKTKKIKECL QQLDIKQGQT  120
LQEPLVHPLL FSSQQQGDPI ALALTRVPNE TNLSDHNHEA AGWHLPW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451085.19e-32hypothetical protein SORBIDRAFT_05g023895
TrEMBLC5Y5X69e-32C5Y5X6_SORBI; Putative uncharacterized protein Sb05g023895
STRINGSb05g023895.13e-31(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4257633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-15M-type_MADS family protein